.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dq0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic and mutational studies of seryl-tRNA synthetase from the archaeon Pyrococcus horikoshii. Rna Biol. 5 54-62 2008
    Site RSGI
    PDB Id 2dq0 Target Id pho001000710.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13854, Molecular Weight 53798.21 Da.
    Residues 460 Isoelectric Point 6.33
    Sequence megidmldiklirenpelvkndlikrgelekvkwvdeilkldtewrtklkeinrlrhernkiaveigkr rkkgepvdellaksreivkrigeleneveelkkkidyylwrlpnithpsvpvgkdendnvpirfwgkar vwkghlerfleqsqgkmeyeilewkpklhvdlleilggadfaraakvsgsrfyyllneivildlalirf aldrliekgftpvippymvrrfveegstsfedfedviykvededlyliptaehplagmhaneildgkdl pllyvgvspcfrkeagtagkdtkgifrvhqfhkveqfvysrpeeswewhekiirnaeelfqeleipyrv vnictgdlgyvaakkydieawmpgqgkfrevvsasnctdwqarrlnirfrdrtdekpryvhtlnstaia tsraivailenhqeedgtvripkvlwkytgfkeivpvekkerccat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.248
    Matthews' coefficent 3.42 Rfactor 0.192
    Waters 159 Solvent Content 64.00

    Ligand Information
    Ligands SO4 (SULFATE) x 7;SSA (5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch