.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dr3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dr3 Target Id pho001000284.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13808, Molecular Weight 27529.63 Da.
    Residues 247 Isoelectric Point 9.08
    Sequence mtrrvktgipgvdeilhggipernvvllsggpgtgktifsqqflwnglkmgepgiyvaleehpvqvrqn maqfgwdvkpyeekgmfamvdaftagigkskeyekyivhdltdirefievlrqairdinakrvvvdsvt tlyinkpamarsiilqlkrvlagtgctsifvsqvsvgergfggpgvehgvdgiirldldeidgelkrsl ivwkmrgtshsmrrhpfditdkgiivypdkvlkrgkvlel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.295
    Matthews' coefficent 2.41 Rfactor 0.251
    Waters 1242 Solvent Content 48.87

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch