The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PH1069 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2drv Target Id pho001001069.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13968, Molecular Weight 23176.92 Da.
    Residues 200 Isoelectric Point 9.33
    Sequence mllymrftenferakkealmsleialrkgevdediipllkkinsienyfttsscsgrisvmemphfgdk vnakwlgkwhrevslyevleaikkhrsgqlwflvrspilhvgaktledavklvnlavscgfkysniksi snkkliveirstermdvllgengeifvgeeylnkiveiandqmrrfkeklkrleskinalnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.245
    Matthews' coefficent 2.20 Rfactor 0.218
    Waters 379 Solvent Content 43.10

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch