.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dsj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project ID TT0128 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dsj Target Id ttk003000128.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14239, Molecular Weight 45367.81 Da.
    Residues 423 Isoelectric Point 6.22
    Sequence mnpvafirekregkkhrredleafllgylrdevpdyqvsawlmaaflrgldpeetlwltetmarsgkvl dlsglphpvdkhssggvgdkvslvvgpilaasgctfakmsgrglahtggtidklesvpgwrgemteaef lerarrvglviaaqspdlapldgklyalrdvtatvesvpliassimskklaagarsivldvkvgrgafm ktleearllaktmvaigqgagrrvralltsmeaplgravgnaievreaiealkgegpgdllevalalae ealrlegldpalarkaleggaalekfrafleaqggdpravedfsllplaeehplraeregvvrevdayk vglavlalgggrkrkgepidhgvgvyllkkpgdrvergealalvyhrrrgleealghlreayalgeeah paplvleai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.222
    Matthews' coefficent 2.56 Rfactor 0.198
    Waters 830 Solvent Content 51.97

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch