The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mutant N33D structure of phenylacetic acid degradation protein PaaI from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dsl Target Id ttk003000310.6
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14330, Molecular Weight 14262.40 Da.
    Residues 136 Isoelectric Point 6.05
    Sequence mrdpfmealglkvlhlapgeavvagevradhldlhgtahggflyaladsafalasntrgpavalscrmd yfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggdgddvpagtgnlaprea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.215
    Matthews' coefficent 2.03 Rfactor 0.19
    Waters 233 Solvent Content 39.48

    Ligand Information
    Metals MG (MAGNESIUM) x 1;CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch