.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dst

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the minimized alpha/beta-hydrolase fold protein from Thermus thermophilus HB8. Acta Crystallogr.,Sect.F 63 993-997 2007
    Site RSGI
    PDB Id 2dst Target Id ttk003001977.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14824, Molecular Weight 14068.58 Da.
    Residues 131 Isoelectric Point 5.30
    Sequence mrragylhlyglnlvfdrvgkgppvllvaeeasrwpealpegyafylldlpgygrtegprmapeelahf vagfavmmnlgapwvllrglglalgphlealglralpaegvevaevlssklsygnidlggnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 2.19 Rfactor 0.201
    Waters 146 Solvent Content 43.95

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch