.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dsy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a UPF0150-family protein from Thermus thermophilus HB8. ACTA CRYSTALLOGR.,SECT.F 63 173-177 2007
    Site RSGI
    PDB Id 2dsy Target Id ttk003001515.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14736, Molecular Weight 9676.42 Da.
    Residues 87 Isoelectric Point 4.32
    Sequence mdgmgtltryleeamararyeliadeepyygeipdlpgvwatgkslkeceanlqaaledwllfllsrge tppplgevrielphgeaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.232
    Matthews' coefficent 1.98 Rfactor 0.183
    Waters 174 Solvent Content 37.91

    Ligand Information
    Ligands NHE (2-[N-CYCLOHEXYLAMINO]ETHANE) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch