The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA1657 (AT-rich DNA-binding protein; p25) from Thermus thermophilus HB8 at 2.16 A resolution. Proteins 66 755-759 2007
    Site RSGI
    PDB Id 2dt5 Target Id ttk003000713.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14414, Molecular Weight 23220.83 Da.
    Residues 211 Isoelectric Point 7.86
    Sequence mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgytvpvlkr elrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrvp grieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrlsfailnpkwre emmg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.16 Rfree 0.238
    Matthews' coefficent 3.39 Rfactor 0.195
    Waters 292 Solvent Content 63.72

    Ligand Information
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch