.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dt8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Fatty Acid Binding of a DegV family Protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2dt8 Target Id ttk003001721.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14783, Molecular Weight 30714.35 Da.
    Residues 280 Isoelectric Point 5.94
    Sequence mritlvtdstsdlpqdlrgrlgvrvvplyvnlsgaiyrdweeitpteifqkvregaafpttsqpspedf arvyrealeeadhvlslhisgklsgtvqsaelaaqefpgrvtvvdtqaaslgvgmmvlrakelleegqs leavlaelerlrrdhfvrfsvatleflkrggriggaqaflgtllnlkpvltlkegrveaagrargekka reeilkafrawaegrkrirayflysgdedavaalrqevlasglpveealvnelgaviashtgpgtygfy aysl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.48 Rfree 0.197
    Matthews' coefficent 2.05 Rfactor 0.173
    Waters 332 Solvent Content 40.05

    Ligand Information
    Ligands PLM (PALMITIC) x 1;GOL (GLYCEROL) x 1
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch