.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dtc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MS0666. To be Published
    Site RSGI
    PDB Id 2dtc Target Id mmt008001402.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13653, Molecular Weight 14421.87 Da.
    Residues 126 Isoelectric Point 9.85
    Sequence ptmegplrrktllkegrkpalsswtrywvvlsgatllyygakslrgtdrkhykstpgkkvsivgwmvql pddpehpdifqlnnpdkgnvykfqtgsrfhailwhkhlddackssrpqvpanlmsfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.234
    Matthews' coefficent 1.94 Rfactor 0.192
    Waters 288 Solvent Content 36.65

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch