The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea. Nat.Struct.Mol.Biol. 14 272-279 2007
    Site RSGI
    PDB Id 2du7 Target Id ar_001000591.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS12194, Molecular Weight 63430.37 Da.
    Residues 549 Isoelectric Point 6.35
    Sequence mklkhkrddkmrfdikkvlelaekdfetawretralikdkhidnkyprlkpvygkphpvmetierlrqa ylrmgfeeminpvivdemeiykqfgpeamavldrcfylaglprpdvglgnekveiiknlgidideekke rlrevlhlykkgaidgddlvfeiakalnvsnemglkvletafpefkdlkpesttltlrshmtsgwfitl sslikkrklplklfsidrcfrreqredrshlmsyhsascvvvgedvsvddgkvvaegllaqfgftkfkf kpdekkskyytpetqtevyayhpklgewievatfgvyspialakynidvpvmnlglgverlamiiygye dvramvypqfyeyrlsdrdiagmirvdkvpildefynfanelidiciankdkespcsvevkrefnfnge rrvikveifenepnkkllgpsvlnevyvydgniygipptfegvkeqyipilkkakeegvstniryidgi iyklvakieealvsnvdefkfrvpivrslsdinlkidelalkqimgenkvidvrgpvflnakveik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.60 Rfree 0.387
    Matthews' coefficent 3.64 Rfactor 0.33
    Waters Solvent Content 66.20

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch