.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dum

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein, PH0823. To be Published
    Site RSGI
    PDB Id 2dum Target Id pho001000823.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13945, Molecular Weight 19261.35 Da.
    Residues 167 Isoelectric Point 6.24
    Sequence mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaeielkdikekl keeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrgklslsheflgstvm rvlrktkkpvliikevdenelaktkgtsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.75 Rfree 0.27918
    Matthews' coefficent 2.96 Rfactor 0.21554
    Waters 28 Solvent Content 58.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch