.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dun

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of BRCT domain of DNA polymerase mu. To be Published
    Site RSGI
    PDB Id 2dun Target Id hss001002753.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13306, Molecular Weight 13007.24 Da.
    Residues 120 Isoelectric Point 8.47
    Sequence strfpgvaiylveprmgrsrrafltglarskgfrvldacsseathvvmeetsaeeavswqerrmaaapp gctppalldiswlteslgagqpvpvecrhrlevagprkgplspawmpayac
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch