The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of competence protein ComEA-related protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2duy Target Id ttk003001215.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14665, Molecular Weight 8182.25 Da.
    Residues 75 Isoelectric Point 9.81
    Sequence mrvealgkvaplpqaqtpvslneasleelmalpgigpvlarrivegrpyarvedllkvkgigpatlerl rpylrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.218
    Matthews' coefficent 1.47 Rfactor 0.188
    Waters 37 Solvent Content 16.45

    Ligand Information
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch