.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dv5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of diphthine synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dv5 Target Id pho001000725.10
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13858, Molecular Weight 29532.70 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredveanfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.228
    Matthews' coefficent 3.21 Rfactor 0.198
    Waters 436 Solvent Content 61.71

    Ligand Information
    Ligands SO4 (SULFATE) x 7;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2;GOL (GLYCEROL) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch