.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dv7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of diphthine synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dv7 Target Id pho001000725.12
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13860, Molecular Weight 29602.79 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllrvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.241
    Matthews' coefficent 3.26 Rfactor 0.215
    Waters 313 Solvent Content 62.29

    Ligand Information
    Ligands SO4 (SULFATE) x 5;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 3;GOL (GLYCEROL) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch