.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dvm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NAD complex structure of PH1275 protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2dvm Target Id pho001001275.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13981, Molecular Weight 48001.00 Da.
    Residues 439 Isoelectric Point 6.16
    Sequence mirekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeytskgnlvavv sdgsrilglgnigplaglpvmegkallfkrfggvdafpimikeqepnkfidivkaiaptfgginledia spkcfyilerlreeldipvfhddqqgtaavvlagllnalkvvgkkiseitlalfgagaagfatlrilte agvkpenvrvvelvngkpriltsdldleklfpyrgwllkktngenieggpqealkdadvlisftrpgpg vikpqwiekmnedaivfplanpvpeilpeeakkagarivatgrsdypnqinnllgfpgifrgaldvrar titdsmiiaaakaiasiveepseeniipsplnpivyarearavaeeamkegvartkvkgewveehtirl iefyenviapinkkrreyskaitra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.207
    Matthews' coefficent 2.73 Rfactor 0.191
    Waters 1830 Solvent Content 54.96

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch