.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of dimeric nonstandard nucleotide triphosphate pyrophosphatase from Pyrococcus horikoshii OT3: functional significance of interprotomer conformational changes. J.Mol.Biol. 375 1013-1025 2008
    Site RSGI
    PDB Id 2dvp Target Id pho001001917.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14016, Molecular Weight 21204.38 Da.
    Residues 186 Isoelectric Point 6.86
    Sequence mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpepfmiedsglf ieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkaykfsgvtwgrisnekrgth gfgydpifipegsektfaemtieeknalshrgkalkaffewlkvnlky
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.27623
    Matthews' coefficent 2.72 Rfactor 0.244
    Waters 107 Solvent Content 54.83

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch