.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dvs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain. J.Biol.Chem. 285 7610-7618 2010
    Site RSGI
    PDB Id 2dvs Target Id ar_001000221.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12129, Molecular Weight 13623.90 Da.
    Residues 122 Isoelectric Point 7.08
    Sequence krrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelvvtipkns hkkgaklaalqgsvtsahqvpavssvshtalytpppeipttvfniphpsviss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.231
    Matthews' coefficent 2.30 Rfactor 0.192
    Waters 250 Solvent Content 47.00

    Ligand Information
    Ligands ALY (N(6)-ACETYLLYSINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch