.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dvv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the second bromodomain of the human Brd2 protein. To be Published
    Site RSGI
    PDB Id 2dvv Target Id hso003006073.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13093, Molecular Weight 12746.98 Da.
    Residues 108 Isoelectric Point 8.02
    Sequence eqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmenrdyrdaqefaa dvrlmfsncykynppdhdvvamarklqdvfefryakmpd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.239
    Matthews' coefficent 2.30 Rfactor 0.188
    Waters 270 Solvent Content 48.00

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch