.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dvw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome. Structure 15 179-189 2007
    Site RSGI
    PDB Id 2dvw Target Id mmk001001374.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13427, Molecular Weight 25052.13 Da.
    Residues 231 Isoelectric Point 5.68
    Sequence megcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlgvpvndk ddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiavmllegganpdakdhy datamhraaakgnlkmvhillfykastniqdtegntplhlacdeerveeakflvtqgasiyienkeekt plqvakgglglilkrlaegeeasm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.238
    Matthews' coefficent 2.38 Rfactor 0.169
    Waters 285 Solvent Content 48.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch