The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Aurora-A kinase complexed with AMPPNP. To be Published
    Site RSGI
    PDB Id 2dwb Target Id ar_001000141.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12126, Molecular Weight 32635.71 Da.
    Residues 282 Isoelectric Point 9.11
    Sequence eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqshlrh pnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychskrvihrdikp enlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhdekvdlwslgvlcyeflvgkpp feantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitansskpsncqnke saskqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.275
    Matthews' coefficent 2.51 Rfactor 0.227
    Waters 30 Solvent Content 51.03

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch