The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Thermus thermophilus YchF GTP-binding protein. To be Published
    Site RSGI
    PDB Id 2dwq Target Id ttk003001291.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14679, Molecular Weight 40508.14 Da.
    Residues 368 Isoelectric Point 5.43
    Sequence mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakgervppvvpt hvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdvvhvmgrvdpledaevvetellla dlatlerrlerlrkearadrerlplleaaeglyvhlqegkpartfppseavarflketplltakpviyv anvaeedlpdgrgnpqveavrrkaleegaevvvvsarleaelaelsgeearellaayglqesglqrlar agyraldlltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarakerg wvrlegkdyevqdgdviyvlfna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.95 Rfree 0.281
    Matthews' coefficent 3.03 Rfactor 0.208
    Waters 31 Solvent Content 59.47

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch