.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dwv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of an atypical WW domain in a novel beta-clam-like dimeric form. Febs Lett. 581 462-468 2007
    Site RSGI
    PDB Id 2dwv Target Id mmi002016694.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13395, Molecular Weight 4302.50 Da.
    Residues 36 Isoelectric Point 6.08
    Sequence plereglppgwervessefgtyyvdhtnkraqyrhp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch