.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bromodomain-containing protein 4. To be Published
    Site RSGI
    PDB Id 2dww Target Id ar_001000372.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12151, Molecular Weight 10277.29 Da.
    Residues 87 Isoelectric Point 5.54
    Sequence awpfykpvdvealglhdycdiikhpmdmstiksklesreyrdaqefgadvrlmfsncykynppdhevva marklqdvfemrfakmpd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.245
    Matthews' coefficent 2.40 Rfactor 0.186
    Waters 186 Solvent Content 48.00

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch