The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of the PHD Domain of the Transcription Coactivator Pygopus. To be Published
    Site RSGI
    PDB Id 2dx8 Target Id mmt007007653.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13503, Molecular Weight 7230.59 Da.
    Residues 67 Isoelectric Point 4.31
    Sequence hghsssdpvypcgictnevnddqdailceascqkwfhrictgmtetayglltaeasavwgcdtcmad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.25495
    Matthews' coefficent 2.97 Rfactor 0.1965
    Waters 67 Solvent Content 58.56

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch