.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dxd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of nucleoside diphosphate kinase in complex with ATP analog. To be Published
    Site RSGI
    PDB Id 2dxd Target Id pho001000698.4
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13851, Molecular Weight 18313.35 Da.
    Residues 160 Isoelectric Point 5.99
    Sequence mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffkalid yitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvihasdskesaereisl ffkpeelfeypraadwfykkgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.77 Rfree 0.193
    Matthews' coefficent 3.40 Rfactor 0.169
    Waters 434 Solvent Content 63.86

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 2
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch