.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dxu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate. J.Biol.Chem. 283 14739-14750 2008
    Site RSGI
    PDB Id 2dxu Target Id pho001000147.16
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13772, Molecular Weight 25985.05 Da.
    Residues 235 Isoelectric Point 8.65
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.28 Rfree 0.2325
    Matthews' coefficent 2.16 Rfactor 0.2225
    Waters 540 Solvent Content 43.02

    Ligand Information
    Ligands BT5 (BIOTINYL-5-AMP) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch