The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of EF-G-2 from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2dy1 Target Id ttk003000868.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14464, Molecular Weight 73133.66 Da.
    Residues 665 Isoelectric Point 5.28
    Sequence mgteggamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtgvapl lfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerlglprmvvvtkldk ggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryengeereaevppeerervqrfrqe vleaivetdegllekylegeevtgealekafheavrrgllypvalasgereigvlpllelilealpspt erfgdgpplakvfkvqvdpfmgqvaylrlyrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeag fvlgvpkaeglhrgmvlwqgekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslkl erqeetgelllwghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqygdv wlrlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyngsyhevdssdlaf qiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgrilgmeqegalsvvhaevplae vleyykalpgltggagaytlefshyaevpphlaqrivqeraqeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.204
    Matthews' coefficent 2.74 Rfactor 0.188
    Waters 598 Solvent Content 55.08

    Ligand Information
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch