.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dya

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of complex between Adenine nucleotide and nucleoside diphosphate kinase. To be Published
    Site RSGI
    PDB Id 2dya Target Id pho001000698.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13848, Molecular Weight 18313.35 Da.
    Residues 160 Isoelectric Point 5.99
    Sequence mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffkalid yitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvihasdskesaereisl ffkpeelfeypraadwfykkgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.77 Rfree 0.169
    Matthews' coefficent 2.05 Rfactor 0.114
    Waters 334 Solvent Content 39.91

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch