.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dyh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Different electrostatic potentials define ETGE and DLG motifs as hinge and latch in oxidative stress response. Mol.Cell.Biol. 27 7511-7521 2007
    Site RSGI
    PDB Id 2dyh Target Id ar_001000355.3
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12150, Molecular Weight 33857.26 Da.
    Residues 309 Isoelectric Point 6.14
    Sequence qavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssveryeperdewhl vapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmntirsgagvcvlhnciya aggydgqdqlnsverydvetetwtfvapmrhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtw sevtrmtsgrsgvgvavtmepcrkqidqqnctc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.21102
    Matthews' coefficent 2.34 Rfactor 0.17237
    Waters 307 Solvent Content 47.45

    Ligand Information
    Ligands TRP-ARG-GLN-ASP-ILE-ASP (SULFATE) x 1;SO4 x 7
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch