The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal GTP-binding domain of EngA from Thermus thermophilus HB8. to be published
    Site RSGI
    PDB Id 2dyk Target Id ttk003001388.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14715, Molecular Weight 48956.91 Da.
    Residues 431 Isoelectric Point 7.87
    Sequence mhkvvivgrpnvgksslfnrllkkrsavvadvpgvtrdlkegvvetdrgrfllvdtgglwsgdkwekki qekvdraledaevvlfavdgraeltqadyevaeylrrkgkpvilvatkvddpkhelylgplyglgfgdp iptssehargleelleaiwerlpvrqietepevagirlaivgrpnagkssllnailgeervivseepgt trdaidvefffggqrfvlvdtagirkrpenlveelairrslramdeadvvllvvdpfqvgdrelklane aldrgkpvllvitkwdlvdkedapkmrrllreklahldhlprvftsaltrqnldrifreavrlhelnqt rvptaelnrwvavwtsrvqmpnfkgkplkilyatqpevapptfvffvnhpefvtrafenylknrigedl glrevpfrlvfrgrree
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.225
    Matthews' coefficent 2.20 Rfactor 0.195
    Waters 144 Solvent Content 43.20

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch