The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the C-terminal Phophotyrosine Interaction Domain of Human APBB3. To be Published
    Site RSGI
    PDB Id 2dyq Target Id hsi002009772.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12423, Molecular Weight 14772.18 Da.
    Residues 137 Isoelectric Point 4.98
    Sequence ldavsqaaqkyealymgtlpvtkamgmdvlneaigtltargdrnawvptmlsvsdslmtahpiqaeast eeeplwqcpvrlvtfigvgrdphtfgliadlgrqsfqcaafwcqphagglseavqaacmvqyqkclva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.10 Rfree 0.298
    Matthews' coefficent 3.29 Rfactor 0.254
    Waters Solvent Content 62.58

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch