.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dza

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Dihydropteroate Synthase (FolP) from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dza Target Id ttk003000191.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14268, Molecular Weight 31847.18 Da.
    Residues 294 Isoelectric Point 6.81
    Sequence mgapplgptiippvrtlwlrdraldldrvrllgvlnltpdsfsdggryldperaleraremvaegadil dlgaestrpgaapvpveeekrrllpvleavlslgvpvsvdtrkpevaeealklgahllndvtglrderm valaarhgvaavvmhmpvpdpatmmaharyrdvvaevkafleaqarralsagvpqvvldpgfgfgklle hnlallrrldeivalghpvlvglsrkrtigelsgvedpaqrvhgsvaahlfavmkgvrllrvhdvrahr ealgvwealyggdrpsra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.233
    Matthews' coefficent 2.45 Rfactor 0.215
    Waters 408 Solvent Content 49.78

    Ligand Information
    Ligands PAB (4-AMINOBENZOIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch