The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX). To be Published
    Site RSGI
    PDB Id 2dzi Target Id hss001002639.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13301, Molecular Weight 8230.28 Da.
    Residues 74 Isoelectric Point 9.73
    Sequence mqltvkalqgrecslqvpedelvstlkqlvseklnvpvrqqrllfkgkaladgkrlsdysigpnsklnl vvkpl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch