The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome. Biochem.Biophys.Res.Commun. 359 503-509 2007
    Site RSGI
    PDB Id 2dzn Target Id ar_001000295.2
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS12140, Molecular Weight 25614.98 Da.
    Residues 228 Isoelectric Point 5.98
    Sequence msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenvnlddypd dsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfevsqfliengasvrikdk fnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhalaeghgdaavllvekygaeydlvdnk gakaedvalneqvkkfflnnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.265
    Matthews' coefficent 2.08 Rfactor 0.197
    Waters 472 Solvent Content 40.90

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch