.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dzr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-067, a GTF2I domain in human cDNA. To be published
    Site RSGI
    PDB Id 2dzr Target Id hso002000922.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12938, Molecular Weight 9694.88 Da.
    Residues 86 Isoelectric Point 9.72
    Sequence lreqvqdlfnkkygealgikypvqvpykriksnpgsviieglppgipfrkpctfgsqnlerilavadki kftvtrpfqglipkpde
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch