The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of mutant tryptophan synthase alpha-subunits from a hyperthermophile, Pyrococcus furiosus. To be Published
    Site RSGI
    PDB Id 2dzu Target Id my_001000046.5
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13727, Molecular Weight 27494.36 Da.
    Residues 248 Isoelectric Point 8.98
    Sequence mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralkngfklreaf wivkefrrhsstpivlmtyynpiyragvrnflaeakasgvngilvvdlpvfhakefteiareegiktvf laapntpderlkviddmttgfvylvslygttgareeipktaydllrrakricrnkvavgfgvskrehvv sllkegangvvvgsalvkiigekgreateflkkkveellgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.26
    Matthews' coefficent 2.15 Rfactor 0.193
    Waters 433 Solvent Content 42.75

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch