The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of catalytic domain of dual specificity phosphatase 26, MS0830 from Homo sapiens. To be Published
    Site RSGI
    PDB Id 2e0t Target Id hsi002021299.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12529, Molecular Weight 17021.67 Da.
    Residues 151 Isoelectric Point 9.51
    Sequence hadevwpglylgdqdmannrrelrrlgithvlnashsrwrgtpeayeglgirylgveahdspafdmsih fqtaadfihralsqpggkilvhcavgvsrsatlvlaylmlyhhltlveaikkvkdhrgiipnrgflrql laldrrlrqglea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.67 Rfree 0.212
    Matthews' coefficent 2.24 Rfactor 0.172
    Waters 263 Solvent Content 44.97

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch