.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e1b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii. ACTA CRYSTALLOGR.,SECT.D 63 390-400 2007
    Site RSGI
    PDB Id 2e1b Target Id pho001000108.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13764, Molecular Weight 25297.72 Da.
    Residues 216 Isoelectric Point 6.03
    Sequence minmtrklyyedaylkeakgrvleirdnailldqtifyptgggqphdrgtingvevldvykdeegnvwh vvkepekfkvgdevelkidwdyryklmrihtglhllehvlnevlgegnwqlvgsgmsvekgrydiaype nlnkykeqiislfnkyvdeggevkiwwegdrrytqirdfevipcggthvkdikeighikklkrssigrg kqrlemwle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.313
    Matthews' coefficent 2.65 Rfactor 0.227
    Waters Solvent Content 53.56

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch