.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e1d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mouse transaldolase. To be Published
    Site RSGI
    PDB Id 2e1d Target Id mmt007100385.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13593, Molecular Weight 35671.99 Da.
    Residues 322 Isoelectric Point 5.86
    Sequence mesaldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkklggpqeeq iknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykeagvgkdriliklsstwe giqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgrildwhvantdkksyepqgdpgvksv tkiynyykkfgyktivmgasfrntgeikalagcdfltispkllgellkdnsnlapalsvkaaqtsdsek ihldekafrwlhnedqmaveklsdgirkfaadaiklermltermfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.211
    Matthews' coefficent 2.32 Rfactor 0.169
    Waters 654 Solvent Content 46.87

    Ligand Information
    Ligands SO3 (SULFITE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch