The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-028, a homeobox domain from human cDNA. To be Published
    Site RSGI
    PDB Id 2e1o Target Id hss001000069.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13176, Molecular Weight 7050.85 Da.
    Residues 57 Isoelectric Point 11.03
    Sequence kggqvrfsndqtielekkfetqkylspperkrlakmlqlserqvktwfqnrrakwrr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch