.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e21

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the initial binding of tRNA(Ile) lysidine synthetase TilS with ATP and L-lysine. To be Published
    Site RSGI
    PDB Id 2e21 Target Id aae001001887.4
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12084, Molecular Weight 37318.53 Da.
    Residues 317 Isoelectric Point 9.17
    Sequence mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalahfnhmlresa erdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkeilesegfdciatahhlndl letsllfftrgtgldgligflpkeevirrplyyvkrseieeyakfkglrwvedetnyevsiprnrirhr vipelkrinenledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig ekdyekvelvrsllekggevnlgkgkvlkrkerwlcfspev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.294
    Matthews' coefficent 2.73 Rfactor 0.222
    Waters 180 Solvent Content 55.00

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch