The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the GUCT domain from human RNA helicase II/Gubeta reveals the RRM fold, but implausible RNA interactions. Proteins 74 133-144 2008
    Site RSGI
    PDB Id 2e29 Target Id hsi002004504.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12370, Molecular Weight 9620.42 Da.
    Residues 85 Isoelectric Point 4.67
    Sequence feprslitsdkgfvtmtlesleeiqdvscawkelnrklssnavsqitrmcllkgnmgvcfdvptteser lqaewhdsdwilsvpa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch