.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e37

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of TT0471 protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2e37 Target Id ttk003000471.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14376, Molecular Weight 32792.80 Da.
    Residues 310 Isoelectric Point 5.83
    Sequence mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvragsygdlegar avvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqvayrlsglppgrvv gsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargralspedra ridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevegvlevslslprilgag gvegtvypslspeerealrrsaeilkeaafalgf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.255
    Matthews' coefficent 3.10 Rfactor 0.215
    Waters 829 Solvent Content 60.33

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4;SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch