The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RNA binding domain in Insulin-like growth factor 2 mRNA binding protein 3. To be Published
    Site RSGI
    PDB Id 2e44 Target Id hsk003000919.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12830, Molecular Weight 10173.05 Da.
    Residues 89 Isoelectric Point 5.72
    Sequence svpkrqrirklqirnipphlqwevldsllvqygvvesceqvntdsetavvnvtysskdqarqaldklng fqlenftlkvayipdemaaq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch