The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of AQ2163 protein from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2e55 Target Id aae001002163.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12091, Molecular Weight 23531.34 Da.
    Residues 208 Isoelectric Point 6.99
    Sequence mivelshplikhkvntariqdtsaeklrktlkelgfmlvyealkdilleekevrtwignkrfnylneee ivfvpilraglsflegalqvvpnakvgflgikrneetleshiyysrlpelkgkivvildpmlatggtle valreilkhsplkvksvhaiaapeglkrieekfkeveifvgnvderlndkgyiipglgdigdrlyavsvy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.23
    Matthews' coefficent 2.12 Rfactor 0.21
    Waters 357 Solvent Content 42.01

    Ligand Information
    Ligands SO4 (SULFATE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch