.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e58

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MnmC2 from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2e58 Target Id aae001001980.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12088, Molecular Weight 35986.77 Da.
    Residues 308 Isoelectric Point 8.84
    Sequence mkreeylknylesylrkkevslteeefnvilreflrfaynpeesgqeiadtadgsktlihktygepyhs qtagaireslykfvrpsrilekakerkvirildvgfglgynlavalkhlwevnpklrveiisfekellk efpilpepyreihefllervpeyegerlslkvllgdarkrikevenfkadavfhdafspyknpelwtld flslikeridekgywvsyssslsvrkslltlgfkvgssreigrkrkgtvaslkapvppmeenevrklvl spfavpmrdekldkepleilidyllkvykisr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.244
    Matthews' coefficent 2.37 Rfactor 0.201
    Waters 122 Solvent Content 48.08

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 4;BEN (BENZAMIDINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch