The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction. Structure 15 289-297 2007
    Site RSGI
    PDB Id 2e5l Target Id ttk003000838.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14454, Molecular Weight 29275.12 Da.
    Residues 256 Isoelectric Point 5.46
    Sequence mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrggtil fvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspeieerpkkeqvrl khelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialadtdsdpdlvdyiipgndda irsiqlilsravdliiqarggvvepspsyalvqeaeatetpegesevea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.30 Rfree 0.301
    Matthews' coefficent 4.80 Rfactor 0.259
    Waters Solvent Content 74.20

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch