The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2. To be Published
    Site RSGI
    PDB Id 2e5n Target Id hsi002011950.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12464, Molecular Weight 10858.90 Da.
    Residues 93 Isoelectric Point 9.82
    Sequence tisqrpyrdrvihllalkaykkpellarlqkdgvnqkdknslgailqqvanlnskdlsytlkdyvfkel qrdwpgyseidrrslesvlsrkln
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch